Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0306800_circ_g.3 |
| ID in PlantcircBase | osa_circ_023367 |
| Alias | Os_ciR3900 |
| Organism | Oryza sativa |
| Position | chr4: 13827214-13828254 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0306800 |
| Parent gene annotation |
RNA recognition motif, RNP-1 domain containing protein. (Os04t03 06800-01);Similar to OSIGBa0096F13.9 protein. (Os04t0306800-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0306800_circ_g.1 Os04g0306800_circ_g.2 Os04g0306800_circ_g.4 Os04g0306800_circ_g.5 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0306800-02:2 Os04t0306800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223534902 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13828242-13827280(+) 13827412-13828238(-) |
| Potential amino acid sequence |
MTMYSLWQCLCCPYSYTRLQCGEISAT*(+) MLLGGPTSEERSEIIKWQKFLHTEVWCSCKDSTSIATRNTLSF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |