Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0558400_circ_g.2 |
ID in PlantcircBase | osa_circ_038056 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27946504-27947003 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os08g0558400 |
Parent gene annotation |
Similar to Kinesin heavy chain (Fragment). (Os08t0558400-01);Sim ilar to cDNA clone:J023090L01, full insert sequence. (Os08t05584 00-02) |
Parent gene strand | - |
Alternative splicing | Os08g0558000_circ_g.2 Os08g0558000_circ_ag.1 Os08g0558000_circ_g.2 Os08g0558000_circ_g.3 Os08g0558000_circ_g.4 Os08g0558000_circ_ag.5 Os08g0558000_circ_ag.6 Os08g0558200_circ_g.1 Os08g0558200_circ_g.2 Os08g0558200_circ_g.3 Os08g0558400_circ_g.1 Os08g0558400_circ_g.3 Os08g0558600_circ_g.1 Os08g0558600_circ_g.2 Os08g0558600_circ_g.3 Os08g0558600_circ_g.4 Os08g0558600_circ_igg.1 Os08g0558700_circ_g.1 Os08g0558800_circ_g.1 Os08g0558800_circ_g.2 Os08g0558800_circ_g.3 |
Support reads | 29 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0558400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.211862683 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27946945-27946509(+) 27946563-27946968(-) |
Potential amino acid sequence |
MQVLVLPPSESRSNLVSLLSLL*(+) MMKSTLIKDLYGEIDRLKAGTVSLQGCSVIH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |