Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0636900_circ_g.6 |
| ID in PlantcircBase | osa_circ_009851 |
| Alias | Os_ciR1760 |
| Organism | Oryza sativa |
| Position | chr11: 25151818-25152736 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0636900 |
| Parent gene annotation |
Similar to Splicing factor U2af large subunit A. (Os11t0636900-0 1);Nucleotide-binding, alpha-beta plait domain containing protei n. (Os11t0636900-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0636900_circ_g.1 Os11g0636900_circ_g.2 Os11g0636900_circ_g.3 Os11g0636900_circ_g.4 Os11g0636900_circ_g.5 Os11g0636900_circ_g.7 |
| Support reads | 8/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0636900-01:3 Os11t0636900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.324921464 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25152720-25152280(+) |
| Potential amino acid sequence |
MWLCLVLGLLQQQAQEWLLVVPGQIHSRAC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |