Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0557500_circ_g.2 |
| ID in PlantcircBase | osa_circ_038032 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 27896201-27897049 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0557500 |
| Parent gene annotation |
Similar to peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein. (Os08t0557500-01);Similar to predicted protein. (Os08t0557500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0557500-02:3 Os08t0557500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.224703396 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27896681-27896204(+) 27896993-27896220(+) |
| Potential amino acid sequence |
MVMHTSMGDIHLRLYPEECPKTVENFTTHCRNGYYDNLIFHRVIKGFMIQTGDPLGDGTGGQSI WGREFEDEFHKRL*(+) MALVGNQSGEGSSKMNFTKDYKFAHK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |