Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G22740_circ_g.2 |
| ID in PlantcircBase | ath_circ_039838 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 7556220-7556333 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G22740 |
| Parent gene annotation |
Glycosyltransferase (Fragment) |
| Parent gene strand | - |
| Alternative splicing | AT5G22740_circ_g.1 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G22740.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.472226244 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7556247-7556222(-) 7556283-7556330(+) |
| Potential amino acid sequence |
MVMEIVRNKVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIVRNKVKSELPSTFRAFRFQQH RWSCGPANLFRKMVMEIVRNKVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIVRNK(-) MLLKTEGSKSTWKLTFHLVSYDLHNHFPKEICRSTRPSMLLKTEGSKSTWKLTFHLVSYDLHNH FPKEICRSTRPSMLLKTEGSKSTWKLTFHLVSYDLHNHFPKEICRSTRPSMLLKTEGSKSTWKL TFH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |