Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0670500_circ_g.1 |
ID in PlantcircBase | osa_circ_031947 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 27793384-27793488 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0670500 |
Parent gene annotation |
Similar to Multidomain cyclophilin type peptidyl-prolyl cis-tran s isomerase. (Os06t0670500-01);Hypothetical conserved gene. (Os0 6t0670500-02) |
Parent gene strand | + |
Alternative splicing | Os06g0670400_circ_ag.1 Os06g0670400_circ_ag.2 Os06g0670400_circ_ag.3 Os06g0670400_circ_ag.4 Os06g0670400_circ_ag.5 Os06g0670400_circ_ag.6 Os06g0670400_circ_ag.7 Os06g0670500_circ_g.2 Os06g0670500_circ_g.3 Os06g0670500_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0670500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.482732381 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27793399-27793385(+) |
Potential amino acid sequence |
MGACSTRWRRISWHKLGTQLEQELEAILYTR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |