Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0670500_circ_g.1 |
| ID in PlantcircBase | osa_circ_031947 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27793384-27793488 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0670500 |
| Parent gene annotation |
Similar to Multidomain cyclophilin type peptidyl-prolyl cis-tran s isomerase. (Os06t0670500-01);Hypothetical conserved gene. (Os0 6t0670500-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0670400_circ_ag.1 Os06g0670400_circ_ag.2 Os06g0670400_circ_ag.3 Os06g0670400_circ_ag.4 Os06g0670400_circ_ag.5 Os06g0670400_circ_ag.6 Os06g0670400_circ_ag.7 Os06g0670500_circ_g.2 Os06g0670500_circ_g.3 Os06g0670500_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0670500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.482732381 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27793399-27793385(+) |
| Potential amino acid sequence |
MGACSTRWRRISWHKLGTQLEQELEAILYTR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |