Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G160900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001413 |
| Alias | Chr13:43776389|43777354 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 43776389-43777354 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G160900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.013G160900_circ_g.2 orai.013G160900_circ_g.3 |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G160900.3:2 Gorai.013G160900.1:4 Gorai.013G160900.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.589831694 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43777292-43777350(-) 43777310-43776484(+) |
| Potential amino acid sequence |
MRKRDPATAPNVGDRVPYVIIKAAKGAKAYERSEDPIYVLENNIPIDPQYYLENQISKPLLRIF EPILKNASKELLHGSHTRSISISTPSNSGIMKFAKKQLSCIGCKALIWV*(-) MSSFYLIIISSFCQTQISALQPIQLSCFFANFIIPLFDGVDMEMDLV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |