Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.013G160900_circ_g.1 |
ID in PlantcircBase | gra_circ_001413 |
Alias | Chr13:43776389|43777354 |
Organism | Gossypium raimondii |
Position | chrChr13: 43776389-43777354 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.013G160900 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | orai.013G160900_circ_g.2 orai.013G160900_circ_g.3 |
Support reads | 3 |
Tissues | ovule |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Gorai.013G160900.3:2 Gorai.013G160900.1:4 Gorai.013G160900.2:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.589831694 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
43777292-43777350(-) 43777310-43776484(+) |
Potential amino acid sequence |
MRKRDPATAPNVGDRVPYVIIKAAKGAKAYERSEDPIYVLENNIPIDPQYYLENQISKPLLRIF EPILKNASKELLHGSHTRSISISTPSNSGIMKFAKKQLSCIGCKALIWV*(-) MSSFYLIIISSFCQTQISALQPIQLSCFFANFIIPLFDGVDMEMDLV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |