Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G19210_circ_g.1 |
| ID in PlantcircBase | ath_circ_039139 |
| Alias | AT5G19210_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 6463040-6463347 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT5G19210 |
| Parent gene annotation |
DEAD-box ATP-dependent RNA helicase 58, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | inflorescences, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G19210.3:2 AT5G19210.2:2 AT5G19210.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.423777818 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6463040-6463344(+) |
| Potential amino acid sequence |
MCEKTNKHQVLLALLESDAPESAIIFVGEQSEKSKKAGNDPSTTLLMEFLKTSYKGSLEILLLE GDMNFNSRAASLTMCEKTNKHQVLLALLESDAPESAIIFVGEQSEKSKKAGNDPSTTLLMEFLK TSYKGSLEILLLEGDMNFNSRAASLTMCEKTNKHQVLLALLESDAPESAIIFVGEQSEKSKKAG NDPSTTLLMEFLKTSYKGSLEILLLEGDMNFNSRAASLTMCEKTNKHQVLLALLESDAPESAII FVGEQSEKSKKAGNDPSTTLLMEFLKTSYKGSLEILLLEGDMNFNSRAASLT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |