Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0421500_circ_g.2 |
| ID in PlantcircBase | osa_circ_006843 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 14870885-14871281 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0421500 |
| Parent gene annotation |
Similar to cDNA clone:J013149A17, full insert sequence. (Os10t04 21500-01);Similar to cDNA clone:J033095I19, full insert sequence . (Os10t0421500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0421500-02:2 Os10t0421500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123853904 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14871071-14871046(+) 14871272-14871278(-) |
| Potential amino acid sequence |
MKFSICLSLTCINCSTFIVDFLNLRLIVNFALLAMQLISLMVEPFWISILALPPFHQT*(+) MARRAKLTINLKLRKSTINVEQLIHVRLRQILNFMGGKTAYIKFDGTVGVPILRSKRVPPSEI* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |