Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0558800_circ_g.1 |
ID in PlantcircBase | osa_circ_034257 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 22335587-22336100 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0558800 |
Parent gene annotation |
PapD-like domain containing protein. (Os07t0558800-01) |
Parent gene strand | + |
Alternative splicing | Os07g0558800_circ_g.2 |
Support reads | 3 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0558800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.348341537 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22335838-22335604(+) 22335647-22336087(-) |
Potential amino acid sequence |
MRPPGAILAPGETIIATVFKFVEHPENNENVLQKCKVKFKILSLKVKGPMDYAPEMINQDNR*( +) MRLACVLYPDCAPHLLSWLIISGA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |