Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G22920_circ_g.6 |
| ID in PlantcircBase | ath_circ_039925 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 7665676-7665871 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G22920 |
| Parent gene annotation |
E3 ubiquitin-protein ligase RZFP34 |
| Parent gene strand | + |
| Alternative splicing | AT5G22920_circ_g.1 AT5G22920_circ_g.2 AT5G22920_circ_g.3 AT5G22920_circ_g.4 AT5G22920_circ_g.5 AT5G22920_circ_g.7 AT5G22920_circ_g.8 AT5G22920_circ_g.9 AT5G22920_circ_g.10 AT5G22920_circ_g.11 AT5G22920_circ_g.12 AT5G22920_circ_g.13 |
| Support reads | 2 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G22920.1:2 AT5G22920.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.22150115 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7665827-7665868(+) 7665867-7665868(+) |
| Potential amino acid sequence |
MGKYFCSKCKFFDDDVICSLCETEQDVQQNCSNCGVCMGKYFCSKCKFFDDDVICSLCETEQDV QQNCSNCGVCMGKYFCSKCKFFDDDVICSLCETEQDVQQNCSNCGVCMGKYFCSKCKFFDDD(+ ) MMSYARFVRQNKTFSKTAPIVVYVWGSTSVQNASSSTMMSYARFVRQNKTFSKTAPIVVYVWGS TSVQNASSSTMMSYARFVRQNKTFSKTAPIVVYVWGSTSVQNASSSTM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |