Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0437300_circ_g.5 |
ID in PlantcircBase | osa_circ_028026 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 21417594-21417902 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os05g0437300 |
Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os05t0437300-01) |
Parent gene strand | - |
Alternative splicing | Os05g0437300_circ_g.1 Os05g0437300_circ_g.2 Os05g0437300_circ_g.3 Os05g0437300_circ_g.4 |
Support reads | 4 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0437300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.268070254 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21417608-21417747(-) 21417863-21417747(-) |
Potential amino acid sequence |
MIVLGFQALIQYQSLQEAMDAFGALHGRNIYDGCCQLDIQYSNLSELQVHYNNDRSRFSSPYPV SVTPRSYGCIWCFAWKEHI*(-) MDAFGALHGRNIYDGCCQLDIQYSNLSELQVHYNNDRSRFSSPYPVSVTPRSYGCIWCFAWKEH I*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |