Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0816400_circ_g.7 |
| ID in PlantcircBase | osa_circ_004582 |
| Alias | Os_ciR4245 |
| Organism | Oryza sativa |
| Position | chr1: 34720024-34720517 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0816400 |
| Parent gene annotation |
Similar to microtubule organization protein. (Os01t0816400-01);S imilar to Microtubule bundling polypeptide TMBP200. (Os01t081640 0-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0816400_circ_ag.1 Os01g0816400_circ_ag.2 |
| Support reads | 6 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0816400-02:3 Os01t0816400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.427354909 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34720513-34720498(-) |
| Potential amino acid sequence |
MEKAVKNKVAKAVVPAIDVMFQALSEFGAKVVPPKKILKMLPELFDHPDQNVRASSKGLTLELC RWIGKEPVKAILFEKMRDTMKKELEAELANVSGIAKPTRKIRNQWRRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |