Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G26030_circ_g.1 |
| ID in PlantcircBase | ath_circ_040482 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 9097189-9097434 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G26030 |
| Parent gene annotation |
Ferrochelatase-1, chloroplastic/mitochondrial |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G26030.1:1 AT5G26030.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.250515513 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9097348-9097431(+) |
| Potential amino acid sequence |
MSLQAKNIAANVYVGMRYWYPFTEEAVQQDIIRLPRPFQFLQGTIAKFISVVRAPKSKEGYAAI GGGSPLRKITDEQADAIKMSLQAKNIAANVYVGMRYWYPFTEEAVQQDIIRLPRPFQFLQGTIA KFISVVRAPKSKEGYAAIGGGSPLRKITDEQADAIKMSLQAKNIAANVYVGMRYWYPFTEEAVQ QDIIRLPRPFQFLQGTIAKFISVVRAPKSKEGYAAIGGGSPLRKITDEQADAIKMSLQAKNIAA NVYVGMRYWYPFTEEAVQQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |