Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0199700_circ_g.8 |
ID in PlantcircBase | osa_circ_008775 |
Alias | Os_ciR4607 |
Organism | Oryza sativa |
Position | chr11: 5003722-5004181 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os11g0199700 |
Parent gene annotation |
Similar to VHS and GAT domain protein. (Os11t0199700-01);Similar to Seed protein B32E (Fragment). (Os11t0199700-02) |
Parent gene strand | - |
Alternative splicing | Os11g0199700_circ_g.7 Os11g0199700_circ_g.9 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0199700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.175723986 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5003747-5003767(-) |
Potential amino acid sequence |
MVKIVKKKTSQGYTQAPKETPGKQEFKSANSDALCARDSKQKLWGCCLPANH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |