Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0199700_circ_g.8 |
| ID in PlantcircBase | osa_circ_008775 |
| Alias | Os_ciR4607 |
| Organism | Oryza sativa |
| Position | chr11: 5003722-5004181 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os11g0199700 |
| Parent gene annotation |
Similar to VHS and GAT domain protein. (Os11t0199700-01);Similar to Seed protein B32E (Fragment). (Os11t0199700-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0199700_circ_g.7 Os11g0199700_circ_g.9 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0199700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.175723986 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5003747-5003767(-) |
| Potential amino acid sequence |
MVKIVKKKTSQGYTQAPKETPGKQEFKSANSDALCARDSKQKLWGCCLPANH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |