Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G036800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000119 |
| Alias | Chr02:2907569|2908022 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 2907569-2908022 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G036800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 144/421 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.002G036800.3:2 Gorai.002G036800.1:2 Gorai.002G036800.4:2 Gorai.002G036800.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000787 |
| PMCS | 1.192024578 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2907986-2907999(+) |
| Potential amino acid sequence |
MSLVAELESLWLFSKTKYAIMIFHCVHKGALTAPGKVLPYEFQCSCCPRSEYTFIILLRSIAVI EDLSACFPYNVTSG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |