Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0649100_circ_g.3 |
| ID in PlantcircBase | osa_circ_002910 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 26191883-26192922 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0649100 |
| Parent gene annotation |
Malate dehydrogenase. (Os01t0649100-01);Malate dehydrogenase. (O s01t0649100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0649100_circ_g.2 Os01g0649100_circ_g.4 Os01g0649100_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0649100-01:3 Os01t0649100-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002256* |
| PMCS | 0.218034607 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26191896-26191895(+) 26192162-26191965(+) 26191898-26192846(-) |
| Potential amino acid sequence |
MISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVTDVNVPVVGGHAG ITILPLFSQATPATNALSDEDIKALTKRTQDGGTEVVEAKAGKGSATLSMALLST*(+) MSQLLVVMRVSPSCHCSHRQLLQLMRCLMKTSRLLPREHRMVGLKLLKQRLERALQPCPWRSCQ HDQQPSEFNGPNCCRGFQEGWDLR*(+) MLTRAPWTRLQSPFQPLLQQLQSHHPVFSW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |