Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0606400_circ_g.4 |
| ID in PlantcircBase | osa_circ_025123 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30625823-30625935 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0606400 |
| Parent gene annotation |
Similar to Mannosyl-oligosaccharide 1,2-alpha-mannosidase (EC 3. 2.1.113). (Os04t0606400-01);Similar to OSIGBa0113I13.2 protein. (Os04t0606400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0606400-02:1 Os04t0606400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.424784513 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30625859-30625859(-) |
| Potential amino acid sequence |
MGLKDEFQRARDHNQRMVSIALVVSGQLLWTHLIHCI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |