Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018484_circ_g.1 |
ID in PlantcircBase | zma_circ_008848 |
Alias | zma_circ_0002027 |
Organism | Zea mays |
Position | chr5: 221668523-221672581 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d018484 |
Parent gene annotation |
Actin-related protein 2/3 complex subunit 1A |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d018484_T008:13 Zm00001d018484_T007:15 Zm00001d018484_T003:13 Zm00001d018484_T010:12 Zm00001d018484_T009:14 Zm00001d018484_T006:15 Zm00001d018484_T001:11 Zm00001d018484_T011:15 Zm00001d018484_T002:14 Zm00001d018484_T004:12 Zm00001d018484_T005:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.050110193 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
221672509-221669043(+) 221668684-221672344(-) |
Potential amino acid sequence |
MKFLPLVCEEFIDMYFMVVWAKGNHWLALDLENLQDPAATNGGPLSTMGNDRSPLDLIVNESLP SSYFAMLTWFSKSHTTTLPSNPDVLNRLIVPSLPFLKGTIHVMQFSWAPPRAFDGSTVSLLAPC FDCPYSFPRASES*(+) MGFGKPRQHCKIARGKAFVNNQIEGASVITHRAQGTTIRGSGVLQVFKIQGQPVIAFCPNNHEV HIYKFFTDKWEKLHVLSKHDQIVSGIDWSNSSNKIVTVSHDRNS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |