Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0646500_circ_g.4 |
| ID in PlantcircBase | osa_circ_031757 |
| Alias | Os_ciR10521 |
| Organism | Oryza sativa |
| Position | chr6: 26408552-26409359 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0646500 |
| Parent gene annotation |
Similar to ATP synthase delta chain, mitochondrial precursor (EC 3.6.3.14) (Oligomycin sensitivity conferral protein) (OSCP). (O s06t0646500-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0646500_circ_g.5 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0646500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.142759313 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26409340-26409153(+) |
| Potential amino acid sequence |
MSQRISWEGSRGFASQVAKPTGKDIKVPEALYGGTGNYASALFLTAAKANLLDKVETEIRDVVE ASKKSPLFSQFIKDLSVPKETRVKAITEIFAEAGFSDVTKNFLGGLKGLRVAGGKADREGYQGS RSSVWWHRQLC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |