Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G55740_circ_g.4 |
| ID in PlantcircBase | ath_circ_007591 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20836257-20836391 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, CIRI-full |
| Parent gene | AT1G55740 |
| Parent gene annotation |
Probable galactinol--sucrose galactosyltransferase 1 |
| Parent gene strand | - |
| Alternative splicing | AT1G55740_circ_g.1 AT1G55740_circ_g.2 AT1G55740_circ_g.3 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G55740.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187650933 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20836329-20836388(+) |
| Potential amino acid sequence |
MEPSRSTSFLKRLKSCCPGLSLLLSLTGSLKKQSLVGLPGSFALSMEPSRSTSFLKRLKSCCPG LSLLLSLTGSLKKQSLVGLPGSFALSMEPSRSTSFLKRLKSCCPGLSLLLSLTGSLKKQSLVGL PGSFALSMEPSRSTSFLKRLKSCCPGLS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |