Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0377300_circ_g.1 |
| ID in PlantcircBase | osa_circ_020063 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14900484-14900914 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0377300 |
| Parent gene annotation |
Conserved hypothetical protein. (Os03t0377300-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0377300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004843* osi_circ_013081 osi_circ_013084 |
| PMCS | 0.253346829 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14900730-14900492(+) 14900518-14900857(-) |
| Potential amino acid sequence |
MYFMIFERGPRAFVKATYQTLTRLRSNESPTQYILHSASDMVSTKLAVLTNMQHCLAAFLAEGY R*(+) MPKALGVSPVALSKKSSQAVLHVCQDSKFC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |