Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0377300_circ_g.1 |
ID in PlantcircBase | osa_circ_020063 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 14900484-14900914 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os03g0377300 |
Parent gene annotation |
Conserved hypothetical protein. (Os03t0377300-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0377300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004843* osi_circ_013081 osi_circ_013084 |
PMCS | 0.253346829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14900730-14900492(+) 14900518-14900857(-) |
Potential amino acid sequence |
MYFMIFERGPRAFVKATYQTLTRLRSNESPTQYILHSASDMVSTKLAVLTNMQHCLAAFLAEGY R*(+) MPKALGVSPVALSKKSSQAVLHVCQDSKFC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |