Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0692700_circ_g.3 |
ID in PlantcircBase | osa_circ_026112 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 35446561-35447462 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os04g0692700 |
Parent gene annotation |
SNF2 N-terminal domain and helicase C-terminal domain containing protein, ENL1-like (Os04t0692700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0692700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005876* osi_circ_015060 |
PMCS | 0.104955654 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35446624-35446623(+) 35447203-35446678(-) |
Potential amino acid sequence |
MTVHASYTLLFQELDVLLQGLIHDKLLTILHLHFVLGERGVKPMWRQTRVLLFILKVKILVIKL RLFFAFCSCPKKTSLEDLFIAPSSPKVAVVSVLQNRTP*(+) MQVENGQQLVMDESLKKHIQFLEQQGIAGVNRHGVLFCKTETTATLGDDGAINRSSREVFLGQL QNAKNNRNFITRIFTFRMNKSTLVCRHMGLTPLSPNTKCKWRMVSSLSWMSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |