Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0692700_circ_g.3 |
| ID in PlantcircBase | osa_circ_026112 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 35446561-35447462 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os04g0692700 |
| Parent gene annotation |
SNF2 N-terminal domain and helicase C-terminal domain containing protein, ENL1-like (Os04t0692700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0692700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005876* osi_circ_015060 |
| PMCS | 0.104955654 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35446624-35446623(+) 35447203-35446678(-) |
| Potential amino acid sequence |
MTVHASYTLLFQELDVLLQGLIHDKLLTILHLHFVLGERGVKPMWRQTRVLLFILKVKILVIKL RLFFAFCSCPKKTSLEDLFIAPSSPKVAVVSVLQNRTP*(+) MQVENGQQLVMDESLKKHIQFLEQQGIAGVNRHGVLFCKTETTATLGDDGAINRSSREVFLGQL QNAKNNRNFITRIFTFRMNKSTLVCRHMGLTPLSPNTKCKWRMVSSLSWMSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |