Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0328300_circ_g.1 |
ID in PlantcircBase | osa_circ_014512 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 13285392-13285661 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0328300 |
Parent gene annotation |
Phenol hydroxylase reductase family protein. (Os02t0328300-01);P henol hydroxylase reductase family protein. (Os02t0328300-02) |
Parent gene strand | + |
Alternative splicing | Os02g0328300_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0328300-01:2 Os02t0328300-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.115432099 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13285481-13285409(+) 13285628-13285409(+) |
Potential amino acid sequence |
MAYQDRFTNWESTGLKIIPVLSRADDSWKGERGYVQSGSVTY*(+) MIVGKENGDMFSPVRSLIEFGFAADQRADVRLYYGARNLQTMAYQDRFTNWESTGLKIIPVLSR ADDSWKGERGYVQSGSVTY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |