Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G65580_circ_g.3 |
| ID in PlantcircBase | ath_circ_008824 |
| Alias | At_ciR837 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 24380543-24381169 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G65580 |
| Parent gene annotation |
Type II inositol polyphosphate 5-phosphatase 15 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G65580.2:2 AT1G65580.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134235832 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24381128-24380545(-) |
| Potential amino acid sequence |
MIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKVGLEGSPL GQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKVG LEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRA IGNKVGLEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVP CGFGRAIGNK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |