Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G65580_circ_g.3 |
ID in PlantcircBase | ath_circ_008824 |
Alias | At_ciR837 |
Organism | Arabidpsis thaliana |
Position | chr1: 24380543-24381169 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT1G65580 |
Parent gene annotation |
Type II inositol polyphosphate 5-phosphatase 15 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 8 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G65580.2:2 AT1G65580.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134235832 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24381128-24380545(-) |
Potential amino acid sequence |
MIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKVGLEGSPL GQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRAIGNKVG LEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVPCGFGRA IGNKVGLEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDVDAAAVP CGFGRAIGNK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |