Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0274700_circ_g.1 |
| ID in PlantcircBase | osa_circ_036557 |
| Alias | Os08circ05862/Os_ciR650 |
| Organism | Oryza sativa |
| Position | chr8: 10571907-10572917 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os08g0274700 |
| Parent gene annotation |
Similar to TTN10. (Os08t0274700-01);Similar to TTN10. (Os08t0274 700-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0274700_circ_g.2 Os08g0274700_circ_g.3 |
| Support reads | 10/44/6 |
| Tissues | leaf/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0274700-01:4 Os08t0274700-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007636* |
| PMCS | 0.638683321 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10572901-10571951(+) 10571976-10571928(+) |
| Potential amino acid sequence |
MQDSPFCSCLCQRVTEIKNKQ*(+) MPGYYDIDDILMEEEPISVVFQVSANGVGLLDPGAERNSVEKGAKVDLPFWLAHGLLSLEQAVS INVPPCFTQKTRKEIQADAACVDLRIRCPYFYELGCKIVPFVAAYAKG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |