Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0516200_circ_g.2 |
| ID in PlantcircBase | osa_circ_011604 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 20058715-20058819 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0516200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os12t0516200-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0516200-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20058810-20058816(+) 20058775-20058734(+) 20058769-20058809(-) |
| Potential amino acid sequence |
MLWFCGGVGALTELPLRNEVPLKHEPLTGTLVLLPMLWFCGGVGALTELPLRNEVPLKHEPLTG TLVLLPMLWFCGGVGALTELPLRNEVPLKHEPLTGTLVLLPMLW(+) MSHSQGHWYCCLCCGSAAALAH*(+) MGPHFSVATLLMRQRRRRTTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |