Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0538500_circ_g.4 |
| ID in PlantcircBase | osa_circ_011883 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 21458329-21458764 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0538500 |
| Parent gene annotation |
Similar to PGPD14 protein. (Os12t0538500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0538500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.295580447 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21458383-21458382(+) 21458752-21458755(-) |
| Potential amino acid sequence |
MRQNCPICYEYLFDSLKGTRVLDCGHTMHMECFSEMVEHNKYTCPICSKTALDMTHHWALLDQE GLVMLLLCVITISVWRTQ*(+) MPSDVSYQELSWSILDKCICYVPPSQKSIPCASCVHSRELVFLLMNQIDTHNKLGNSASLSSPH TDGYHAEQQHNKTLLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |