Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0205700_circ_g.2 |
| ID in PlantcircBase | osa_circ_000783 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 5775777-5775872 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder |
| Parent gene | Os01g0205700 |
| Parent gene annotation |
Similar to Shaggy-like kinase (Fragment). (Os01t0205700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0205700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.479165625 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5775790-5775869(+) 5775838-5775779(-) |
| Potential amino acid sequence |
MSLNLRKFELSIVGVHASYFLTGWSTKNLVPRMSLNLRKFELSIVGVHASYFLTGWSTKNLVPR MSLNLRKFELSIVGVHASYFLTGWSTKNLVPRMSLNLRKFELSIVGVHASYFLTGWSTKN(+) MNPNYTEFKFPQIKAHPWHKVLGTPTREEIRCMNPNYTEFKFPQIKAHPWHKVLGTPTREEIRC MNPNYTEFKFPQIKAHPWHKVLGTPTREEIRCMNPNYTEFKFPQIKAHPWHK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |