Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA000605_circ_g.3 |
ID in PlantcircBase | osi_circ_002484 |
Alias | 1:38108009|38108448 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 38108009-38108448 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA000605 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA000605_circ_g.1 BGIOSGA000605_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA000605-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38108099-38108390(-) 38108415-38108436(-) |
Potential amino acid sequence |
MNWSYRLPFLVAMHLNHQSTNQTLEILPLIKSSPEFGIKLVDGRIFGGL*(-) MGGSLVDSSAEGVSSSLCLCHSTSEKAGFEHSSCASSGDGNCEAGIDFGQDDLVVNEIGMAIAE VMHVCSDHDDDEGTDSGEDFDENEGLLSLESDSTDDVVDIDNELVISPTFSSCNASESSINKSD SGNSSINKILS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |