Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0620000_circ_g.22 |
ID in PlantcircBase | osa_circ_025333 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 31511214-31511348 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os04g0620000 |
Parent gene annotation |
C-type ATP-binding cassette (ABC) transporter, Arsenic (As) deto xification, Reduction of As in grains (Os04t0620000-01) |
Parent gene strand | - |
Alternative splicing | Os04g0620000_circ_g.7 Os04g0620000_circ_g.8 Os04g0620000_circ_g.9 Os04g0620000_circ_g.10 Os04g0620000_circ_g.11 Os04g0620000_circ_g.12 Os04g0620000_circ_g.13 Os04g0620000_circ_g.14 Os04g0620000_circ_g.15 Os04g0620000_circ_g.16 Os04g0620000_circ_g.17 Os04g0620000_circ_g.18 Os04g0620000_circ_g.19 Os04g0620000_circ_g.20 Os04g0620000_circ_g.21 Os04g0620000_circ_g.23 Os04g0620000_circ_g.24 Os04g0620000_circ_g.25 Os04g0620000_circ_g.26 Os04g0620000_circ_g.27 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0620000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.316054012 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31511293-31511216(-) 31511324-31511216(-) |
Potential amino acid sequence |
MVLLYAQLGPAALVGAAMLVLLFPIQQVCQQLHSLWSAPFRIVIAMVLLYAQLGPAALVGAAML VLLFPIQQVCQQLHSLWSAPFRIVIAMVLLYAQLGPAALVGAAMLVLLFPIQQVCQQLHSLWSA PFRIVIAMVLLYAQLGPAALVGAAMLVLLFPIQ(-) MVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNSASVPATSQSMVCSFPHCYCHGPSIRTTR PCCIGRCSHVGSFVPNSASVPATSQSMVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNSAS VPATSQSMVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |