Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0620000_circ_g.22 |
| ID in PlantcircBase | osa_circ_025333 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31511214-31511348 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0620000 |
| Parent gene annotation |
C-type ATP-binding cassette (ABC) transporter, Arsenic (As) deto xification, Reduction of As in grains (Os04t0620000-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0620000_circ_g.7 Os04g0620000_circ_g.8 Os04g0620000_circ_g.9 Os04g0620000_circ_g.10 Os04g0620000_circ_g.11 Os04g0620000_circ_g.12 Os04g0620000_circ_g.13 Os04g0620000_circ_g.14 Os04g0620000_circ_g.15 Os04g0620000_circ_g.16 Os04g0620000_circ_g.17 Os04g0620000_circ_g.18 Os04g0620000_circ_g.19 Os04g0620000_circ_g.20 Os04g0620000_circ_g.21 Os04g0620000_circ_g.23 Os04g0620000_circ_g.24 Os04g0620000_circ_g.25 Os04g0620000_circ_g.26 Os04g0620000_circ_g.27 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0620000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.316054012 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31511293-31511216(-) 31511324-31511216(-) |
| Potential amino acid sequence |
MVLLYAQLGPAALVGAAMLVLLFPIQQVCQQLHSLWSAPFRIVIAMVLLYAQLGPAALVGAAML VLLFPIQQVCQQLHSLWSAPFRIVIAMVLLYAQLGPAALVGAAMLVLLFPIQQVCQQLHSLWSA PFRIVIAMVLLYAQLGPAALVGAAMLVLLFPIQ(-) MVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNSASVPATSQSMVCSFPHCYCHGPSIRTTR PCCIGRCSHVGSFVPNSASVPATSQSMVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNSAS VPATSQSMVCSFPHCYCHGPSIRTTRPCCIGRCSHVGSFVPNS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |