Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc04g076210.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001511 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr4: 61150861-61151269 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc04g076210.2 |
| Parent gene annotation |
Ubiquitin carboxyl-terminal hydrolase 16 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc04g076210.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.474324158 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61151124-61150863(+) 61151260-61150863(+) |
| Potential amino acid sequence |
MSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRNFQNKWYKVDDSSM*(+) MIVRCKSYERAKKKLKVVEAPNVLTVALKRFQSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPV YQLYGVVVHLDVMNAAFSGHYVCYVRNFQNKWYKVDDSSM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |