Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015505_circ_g.4 |
ID in PlantcircBase | zma_circ_008626 |
Alias | Zm05circ00070 |
Organism | Zea mays |
Position | chr5: 94168258-94177187 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d015505 |
Parent gene annotation |
Nucleoid-associated protein chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d015505_circ_g.1 Zm00001d015505_circ_g.2 Zm00001d015505_circ_g.3 Zm00001d015505_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d015505_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.085509653 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
94168267-94168266(+) 94168394-94169804(-) |
Potential amino acid sequence |
MNIEGAFCLPCSTRKRASYRPFRVYSLFGGKKDKDENGDEAPSKAGIFGNMQNLYETVKKAQMV VQVEAVRVQKELAATEIDGYCEGELIKVTLSGNQQPIRVEITEAAMELGAEVIE*(+) MAPHHHSHLYPSSLQINCTLGKVYNLLSSLWNTANRKRPLCSFYYFSTQLHRSFCDFNSNRLLV SRKCNLD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |