Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA015183_circ_g.1 |
ID in PlantcircBase | osi_circ_005416 |
Alias | 4:17218427|17220125 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 17218427-17220125 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA015183 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA015183-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17218451-17219120(-) 17220053-17220083(-) 17220051-17218482(+) |
Potential amino acid sequence |
MRTIQLLRWGGGGGGGAGVEEGEREAVRDQGLHDPRRGLERPPPPPQQRI*(-) MIPDEAWNVLHRLRSRGYDVYLVGGCVRDLIMKKTPKDFDIITTADLRQVKDTFSGSAVIVGRR FPICHVYENNSIVEVGRRRRRRRRSGRR*(-) MESLIPNRFALTFFHSGASAAAAAPPQQLNCSHIRDILGTAFLL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |