Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g112080.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000554 |
| Alias | 1:89952510|89952691 |
| Organism | Solanum lycopersicum |
| Position | chr1: 98191710-98191891 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc01g112080.2 |
| Parent gene annotation |
LysM domain-containing GPI-anchored protein 2 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc01g112080.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.388816858 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
98191766-98191732(+) 98191798-98191864(-) |
| Potential amino acid sequence |
MQCQGLDNLYIGNVTDCNSTSCAYAGYSNQTIFTTNTQLTCPGCNANHPR*(+) MYKLSKPWHCIEGHVFQREDFIWDGWHCNQGRLTECLW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |