Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0168600_circ_g.1 |
ID in PlantcircBase | osa_circ_013347 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 3706737-3707852 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0168600 |
Parent gene annotation |
Ovarian tumour, otubain domain containing protein. (Os02t0168600 -01) |
Parent gene strand | - |
Alternative splicing | Os02g0168600_circ_g.2 Os02g0168600_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0168600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165837657 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3707803-3706787(+) 3707605-3707817(-) 3706782-3707800(-) |
Potential amino acid sequence |
MFVIVRIAEYLICQSSELLWEWHLWGLSRLGMCL*(+) MEYKVYLKKMKRSGEWGDHVTLQAAADRFAAKICLLTSFRDTCLIEIVPRGATPTKVPSFGRSD IPQS*(-) MPNRDSPQRCHSHKSSELWQIRYSAILTITNM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |