Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0254700_circ_g.6 |
| ID in PlantcircBase | osa_circ_018903 |
| Alias | Os03circ08899/Os_ciR9181 |
| Organism | Oryza sativa |
| Position | chr3: 8170252-8170416 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os03g0254700 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os03t0254700-01);Si milar to predicted protein. (Os03t0254700-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0254700_circ_g.3 Os03g0254700_circ_g.4 Os03g0254700_circ_g.5 Os03g0254700_circ_g.7 Os03g0254700_circ_g.8 Os03g0254700_circ_g.9 Os03g0254700_circ_g.10 Os03g0254700_circ_g.11 Os03g0254700_circ_g.12 |
| Support reads | 2/2/1 |
| Tissues | leaf/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0254700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.318486616 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8170361-8170290(+) |
| Potential amino acid sequence |
MGRNSQQSTFLVESDPWTCLCYSLRRTPRSIK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |