Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0498800_circ_g.1 |
| ID in PlantcircBase | osa_circ_024434 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 24934081-24934737 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0498800 |
| Parent gene annotation |
Similar to Cell division control protein 48 homolog B (AtCDC48b) . (Os04t0498800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0498800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253547679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24934674-24934246(+) 24934633-24934100(+) 24934121-24934220(-) |
| Potential amino acid sequence |
MARLASPSIIFFDEADAIAPKRKNFSKLLNGPSSMLLHLIDLEYHLSVGCYCMVHQGAQRLPLQ RLLLMLPKLLSFH*(+) MLVKVKLCCDVHSRWHVLLLQALYFLMRLMQLPLKEKTSASC*(+) MLDGPFNSLLKFFLLGAIASASSKNIMLGEARRAIWNVRRNKASPSPTYLEYNSAPLNEKKEAW AA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |