Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa4G083700_circ_g.1 |
| ID in PlantcircBase | csa_circ_002415 |
| Alias | Chr4:5742614_5743477 |
| Organism | Cucumis sativus |
| Position | chrChr4: 5742614-5743477 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa4G083700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa4G083700.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19994131 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5742627-5742707(+) |
| Potential amino acid sequence |
MGEEQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPV NSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVVGGHAGITILPL FSQATPKANLTDDTIVALTKRTQDGGTEVVEAKAGKGSATLSMALLATWVRSNSAKLWRDPMLS SFLLVFQESRA* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |