Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0586700_circ_g.2 |
ID in PlantcircBase | osa_circ_020552 |
Alias | Os_ciR8654 |
Organism | Oryza sativa |
Position | chr3: 21649486-21649769 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0586700 |
Parent gene annotation |
Conserved hypothetical protein. (Os03t0586700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0586700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004933* osi_circ_013232 |
PMCS | 0.513320393 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21649760-21649543(+) 21649618-21649759(-) |
Potential amino acid sequence |
MFSTHQPTIVLHLHQKLMLLFPW*(+) MTPAEVYSVLRNQGYCIDYKRIPLTREREALASDVDAIQSSVDELKT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |