Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G55690_circ_g.5 |
ID in PlantcircBase | ath_circ_007576 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 20810092-20810333 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G55690 |
Parent gene annotation |
Phosphatidylinositol/phosphatidylcholine transfer protein SFH13 |
Parent gene strand | - |
Alternative splicing | AT1G55690_circ_g.1 AT1G55690_circ_g.2 AT1G55690_circ_g.3 AT1G55690_circ_g.4 AT1G55690_circ_g.6 AT1G55690_circ_g.7 AT1G55690_circ_g.8 AT1G55690_circ_g.9 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G55690.1:2 AT1G55690.3:2 AT1G55690.2:2 AT1G55690.4:2 AT1G55690.5:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.19132989 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20810098-20810094(-) |
Potential amino acid sequence |
MKVLEPKSLFKLHEVIDSSQLPEFLGGSCSCFGDGGGCLRSNKGPWNDPEIMKVLEPKSLFKLH EVIDSSQLPEFLGGSCSCFGDGGGCLRSNKGPWNDPEIMKVLEPKSLFKLHEVIDSSQLPEFLG GSCSCFGDGGGCLRSNKGPWNDPEIMK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |