Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA014805_circ_g.1 |
| ID in PlantcircBase | osi_circ_005583 |
| Alias | 4:23336168|23337777 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 23336168-23337777 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA014805 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA014805-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23337736-23337757(-) 23336229-23337768(-) 23337771-23336270(+) |
| Potential amino acid sequence |
MKLPDKTVRDVALRCRWMNKKESGKRKKEDHSSSKKSKDKKEKVSDSSLKPPVHIAGRPNVPPY PLPALPIDDDEISSKGMHLMLL*(-) MFLRTPFQLFPLTMMKFLPKVCI*(-) MHTFGRNFIIVNGKSWKGVRRNIRPSSYMNRWFQRRI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |