Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d009222_circ_g.1 |
ID in PlantcircBase | zma_circ_009587 |
Alias | zma_circ_0002962 |
Organism | Zea mays |
Position | chr8: 44264280-44264781 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d009222 |
Parent gene annotation |
Pyrophosphate-energized vacuolar membrane proton pump 1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d009222_T002:2 Zm00001d009222_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.309835276 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
44264735-44264585(+) 44264440-44264592(-) |
Potential amino acid sequence |
MARPAQSPMATHKNRCLANGGRGVAGGVERVGSLPDPAAHACHLSDPAGVVADGAVGVDGQPRG DRAQHPERGDRDAVDGCQREADVDGHGDGEDGHDDGLVPEGEAEDDVGRSARPA*(+) MLSTVATGLAIDAYGPISDNAGGIAEMAGMSRRIRQRTDALDAAGNTTAAIGKAPVLMRGHWAL GWSRHRLHHRVLHQQRLQPGPGRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |