Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0481700_circ_g.3 |
| ID in PlantcircBase | osa_circ_039591 |
| Alias | Os_ciR11852 |
| Organism | Oryza sativa |
| Position | chr9: 18498856-18499026 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0481700 |
| Parent gene annotation |
SUSIBA2-like (WRKY transcription factor 80). (Os09t0481700-01);S USIBA2-like (WRKY transcription factor 80). (Os09t0481700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0481700-01:1 Os09t0481700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.264702632 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18498994-18498950(+) 18498989-18498858(-) |
| Potential amino acid sequence |
MAVCQWLEKAVPFLQRRNLAVSTLHAVGRRKCHCQMCNLRPSW*(+) MASNAKSTIPSATKMDEDCTFGNDTFSFQPHVGSRRPNFSAAEKAQPSPTTGTLPFLMASNAKS TIPSATKMDEDCTFGNDTFSFQPHVGSRRPNFSAAEKAQPSPTTGTLPFLMASNAKSTIPSATK MDEDCTFGNDTFSFQPHVGSRRPNFSAAEKAQPSPTTGTLPFLMASNAKSTIPSATKMDEDCTF GNDTFSFQPHVGSRRPNFSAAEK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |