Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G041400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000442 |
| Alias | Chr05:3950760|3952020 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 3950760-3952020 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G041400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7/20 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G041400.3:3 Gorai.005G041400.2:3 Gorai.005G041400.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000704 |
| PMCS | 0.446543788 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3951679-3950850(+) 3951681-3951986(-) 3950845-3952012(-) 3951715-3951972(-) |
| Potential amino acid sequence |
MDGKQIKMTEDHKVTSCSERLRIEGIGEPLKDGETRLCGLNLARMLGDKFVKQQDSRFSSEPYI SQVVHLKKSSGAFALLARAVRRHCFWFGLMLMKTFLHNVQMLEILHVL*(+) MFIKHAESPTFAHCAKKFSSASAQTRSSVAVQPLPVVQMRHLIF*(-) MQNLQHLHIVQKSFHQHQPKPEAVSPYSPCQ*(-) MVFSHLNLFTVHVYKTCRISNICTLCKKVFISISPNQKQCRRTALASSANAPLDFLRCTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |