Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0749900_circ_g.4 |
ID in PlantcircBase | osa_circ_003891 |
Alias | Os_ciR4496 |
Organism | Oryza sativa |
Position | chr1: 31398232-31398911 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0749900 |
Parent gene annotation |
Protein of unknown function DUF250 domain containing protein. (O s01t0749900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0749900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010716 |
PMCS | 0.290360858 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31398256-31398346(+) |
Potential amino acid sequence |
MSYVTPVMAITTAILSIAMDPWHDVRASHFFDNSTHIIRSSLLMLLGGALAFFMVLTEYVLVSV TSAVTVTVAGIVKEAVTILVAVLFFNDTFTWLKGLGLGIIIFGVSLFNLYKIKKSLYVDELCYP GYGNNNCNSFYCDGSMARRQGKPLF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |