Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045434_circ_g.2 |
ID in PlantcircBase | zma_circ_009873 |
Alias | zma_circ_0003166, GRMZM5G830776_C1 |
Organism | Zea mays |
Position | chr9: 22064904-22065613 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d045434 |
Parent gene annotation |
SNARE-interacting protein KEULE |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d045434_T002:4 Zm00001d045434_T004:4 Zm00001d045434_T003:4 Zm00001d045434_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.347675929 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22064968-22065063(+) 22065084-22065549(-) |
Potential amino acid sequence |
MVPKWLATAVWEIVSKYKSTIPEFPQKETCELLIVDRPIDQIAPVIHEWTYDAMCHDLLEMDGN KYIYEVSKMGSEPEKKESLLEDHDPLWLELRHAHIADASERLYEKMNNFVAKNKAAQLSRNFHV CGIGRQKEMLPQQLNSIWFQSGLLLLFGKLCQNINQLFLNFPRRRHVNC*(+) MGLSTISSSHVSFWGNSGIVDLYFDTISQTAVASHFGTISNLVVVEASPFGARYRTHGNSLKVV LLYSWQQNCSSFRTTSH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |