Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G39770_circ_g.4 |
| ID in PlantcircBase | ath_circ_017505 |
| Alias | At_ciR3674 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 16589744-16589983 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G39770 |
| Parent gene annotation |
VTC1 |
| Parent gene strand | + |
| Alternative splicing | AT2G39770_circ_g.3 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G39770.1:1 AT2G39770.2:1 AT2G39770.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.435359114 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16589747-16589980(+) |
| Potential amino acid sequence |
MLNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKEMLE FHKSHGGEASIMVTKVMLNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFV LNSDVISEYPLKEMLEFHKSHGGEASIMVTKVMLNFLKDFETKLEIKITCSQETEPLGTAGPLA LARDKLLDGSGEPFFVLNSDVISEYPLKEMLEFHKSHGGEASIMVTKVMLNFLKDFETKLEIKI TCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKEMLEFHKSHGGEASIMVTK( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |