Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d028915_circ_g.10 |
ID in PlantcircBase | zma_circ_006504 |
Alias | zma_circ_0000657, AC208571.4_FG001_C1 |
Organism | Zea mays |
Position | chr1: 51148896-51149267 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d028915 |
Parent gene annotation |
Chloroplast protein HCF243 |
Parent gene strand | + |
Alternative splicing | Zm00001d028915_circ_g.9 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d028915_T010:2 Zm00001d028915_T014:2 Zm00001d028915_T024:2 Zm00001d028915_T009:2 Zm00001d028915_T012:2 Zm00001d028915_T023:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.190850343 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
51149266-51149235(+) |
Potential amino acid sequence |
MIKKLDPVTRKVTTIAGTGSAGYRDGPGLTAQLSEPAGLVEVGDDKKVRSRHKKSYNYCWNGEC RIQGWSRLDSSTF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |