Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d028915_circ_g.10 |
| ID in PlantcircBase | zma_circ_006504 |
| Alias | zma_circ_0000657, AC208571.4_FG001_C1 |
| Organism | Zea mays |
| Position | chr1: 51148896-51149267 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d028915 |
| Parent gene annotation |
Chloroplast protein HCF243 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d028915_circ_g.9 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d028915_T010:2 Zm00001d028915_T014:2 Zm00001d028915_T024:2 Zm00001d028915_T009:2 Zm00001d028915_T012:2 Zm00001d028915_T023:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.190850343 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51149266-51149235(+) |
| Potential amino acid sequence |
MIKKLDPVTRKVTTIAGTGSAGYRDGPGLTAQLSEPAGLVEVGDDKKVRSRHKKSYNYCWNGEC RIQGWSRLDSSTF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |