Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0700700_circ_g.1 |
| ID in PlantcircBase | osa_circ_021117 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 28111072-28111361 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0700700 |
| Parent gene annotation |
Similar to Lipoxygenase (Fragment). (Os03t0700700-01);Similar to Lipoxygenase. (Os03t0700700-02);Similar to Lipoxygenase. (Os03t 0700700-03);Similar to Lipoxygenase. (Os03t0700700-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0700700-03:1 Os03t0700700-02:2 Os03t0700700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.282642816 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28111286-28111093(+) 28111117-28111137(+) 28111303-28111324(-) |
| Potential amino acid sequence |
MCTVTIPARSPKLTLSTTWRASRCKIGQICLED*(+) MLAGVNPVMIKRLTNFPAKSTLDPNVYGDHTSKITEAHIKHNMEGLTVQNRTNLLGGLMRSLHE KCSQELTQ*(+) MVTVHIWIQSTFCREIRQTLDHHWVNSCEHFSCKLLISPPSKFVLFCTVRPSMLCLM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |